PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC518_p3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family GATA
Protein Properties Length: 272aa    MW: 30805.5 Da    PI: 7.6882
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC518_p3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA65.46.2e-21191225135
       GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                C++C ttkTp+WR+gpdg+ktLCnaCG+++r+ +l
  RrC518_p3 191 CTHCETTKTPQWREGPDGPKTLCNACGVRFRSGRL 225
                *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004011.8E-20185235IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.2E-15189222IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011412.202189221IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.38E-15189248No hitNo description
CDDcd002029.31E-18190239No hitNo description
PROSITE patternPS003440191216IPR000679Zinc finger, GATA-type
PfamPF003209.6E-19191225IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MSWLPEEEFK GLSDSFFDDI INHINFPLED TTTGGEGGED WDSKFQHLEP PPMDLFTTFP  60
SEFTSSHVIN KEVAPVPLLE QSSTLQQSSS PPDIKVSKQF QSSSPVSVLE SSDASFSPQN  120
IISQSLTFPV KGMRSKRKRR PTTHRFRYLH PFEPSKLETT YYPPEQHAKK KRKTSSLHTE  180
ASSYDGIVRK CTHCETTKTP QWREGPDGPK TLCNACGVRF RSGRLVPEYR PASSPTFIPS  240
LHSNSHRKII EMRRKESDEF DTSMIHSVIS GA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013716496.11e-156PREDICTED: GATA transcription factor 11-like
SwissprotQ6DBP81e-117GAT11_ARATH; GATA transcription factor 11
TrEMBLA0A0D3DYH31e-156A0A0D3DYH3_BRAOL; Uncharacterized protein
STRINGBra031608.1-P1e-155(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16812589
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.24e-95GATA transcription factor 11